Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rusa unicolor Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Rusa unicolor Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

Q37440

Expression Region

1-227

Origin

Rusa unicolor (Sambar) (Cervus unicolor)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYVISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLYYGQCSEICGSNHSFMPIVLELVPLNYFEKWSASML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-100 1x 100 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL
BNC740226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (84-3C1), CF405S conjugate, 0.1mg/mL
BNC040342-500 1x 500 µL

CD43 (84-3C1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF647 conjugate, 0.1mg/mL
BNC472284-500 1x 500 µL

Human IgG4 (Ig Heavy Constant Gamma 4) (G4m Marker) (rIGHG4/1345), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details