Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Batomys granti Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Batomys granti Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

Q38S23

Expression Region

1-227

Origin

Batomys granti (Luzon hairy-tailed rat) (Luzon forest rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYPFQLGLQDATSPIMEELTNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTTDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL
BNC400630-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-100 1x 100 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL
BNC742848-500 1x 500 µL

Fibronectin (Fn-3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (NCL/902), CF568 conjugate, 0.1mg/mL
BNC680902-500 1x 500 µL

Nucleolin (NCL/902), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 19 (KRT19/799), CF488A conjugate, 0.1mg/mL
BNC880799-100 1x 100 µL

Cytokeratin 19 (KRT19/799), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details