Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anisomys imitator Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Anisomys imitator Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

Q38S38

Expression Region

1-227

Origin

Anisomys imitator (Squirrel-toothed rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYPFQLGLQDATSPIMEELTSFHDHTLMIVFLISSLVLYIILLMLTTKLTHTSTMDAQE VETIWTILPAVILILIALPSLRILYMMDEINNPALTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSASMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL
BNC400437-500 1x 500 µL

CD47 (B6H12.2), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL
BNC042853-100 1x 100 µL

CD54 / ICAM-1 (15.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), 0.2mg/mL
BNUB0345-100 1x 100 µL

CD4 (EDU-2), 0.2mg/mL

Sign In for Pricing
View Details
MTAP (Tumor Suppressor Marker) (MTAP/1813), CF594 conjugate, 0.1mg/mL
BNC941813-100 1x 100 µL

MTAP (Tumor Suppressor Marker) (MTAP/1813), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (CHGA/798), CF594 conjugate, 0.1mg/mL
BNC940798-100 1x 100 µL

Chromogranin A (CHGA/798), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details