Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macrotus californicus Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Macrotus californicus Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

Q37548

Expression Region

1-227

Origin

Macrotus californicus (California big-eared bat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYVISAMLTTNLTHTSTMDAQE VETIWTILPAIILITIALPSLRILYMMDEINNPAMTIKTMGHQWYWSYEYTDYHDLSFDS YMVPTSDLKPGELRLLEVDNRVVLPVEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QTTLLSIRPGLYYGQCSEICGSNHSFMPIVLEVVPLEYFEKWSVSML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL
BNC680965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL
BNC940040-500 1x 500 µL

CD35 / CR1 (E11), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD4 (EDU-2), CF488A conjugate, 0.1mg/mL
BNC880345-500 1x 500 µL

CD4 (EDU-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF568 conjugate, 0.1mg/mL
BNC681786-500 1x 500 µL

P63 (Squamous, Basal and Myoepithelial Cell Marker) (TP63/1786), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD46 (197-2B1), CF568 conjugate, 0.1mg/mL
BNC680931-100 1x 100 µL

CD46 (197-2B1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details