Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bison bison Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Bison bison Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

Q37416

Expression Region

1-227

Origin

Bison bison (American bison) (Bos bison)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYPMQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPFLTVKAMGHQWYWSYEYTDYEDLSFDS YMIPTSELKPGELRLLEVDNRVVLPMEMTIRMLVSSEDVLHSWAVPSLGLKTDAIPGRLN QTTLMSTRPGLYYGQCSEICGSNHSFMPIVLELVPLKYFEKWSASML

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF640R conjugate, 0.1mg/mL
BNC403795-100 1x 100 µL

GLUT-1 (Tumor Progression and Mesothelioma Marker) (rGLUT1/2476), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glycosylated Serum Protein (GSP) Colorimetric Assay Kit
E-BC-K069-M-01 48 T (42 samples)

Glycosylated Serum Protein (GSP) Colorimetric Assay Kit

Sign In for Pricing
View Details
Glycosylated Serum Protein (GSP) Colorimetric Assay Kit
E-BC-K069-M-02 96 T (90 samples)

Glycosylated Serum Protein (GSP) Colorimetric Assay Kit

Sign In for Pricing
View Details
Human EGFR, C-His Tag
HA211104-01 20 µg

Human EGFR, C-His Tag

Sign In for Pricing
View Details
Human EGFR, C-His Tag
HA211104-02 50 µg

Human EGFR, C-His Tag

Sign In for Pricing
View Details
Human EGFR, C-His Tag
HA211104-03 100 µg

Human EGFR, C-His Tag

Sign In for Pricing
View Details