Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0995 (MJ0995)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0995 (MJ0995) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0995

UniProt

Q58402

Expression Region

1-227

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYGDYMKYMKKIVLFLIINILPILILGLYLYANIGGAEDVKEVIENSPFKEFTYIDHKTL MMLKNDVNLKNMPEFYKESIILINGIYIGNHGSFGIKIPLGFLIKYIPIDNFKYYNGVLI KNLNEDDLGKAEMNDLVNTIPPNYKDVLIYRENYTIGIYYDLNSNKTYLIEVFRKPNNQE IDTEKLRNELLQKTNAVDCNVVDMGDKVYVYLEFNGIDLNLINNGIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

4-Cyanopyridine
TRC-C982225-5G 5 g

4-Cyanopyridine

Sign In for Pricing
View Details
Human MCART6 (SLC25A53) activation kit by CRISPRa
GA118342 1 Kit

Human MCART6 (SLC25A53) activation kit by CRISPRa

Sign In for Pricing
View Details
Palladium (5% on Alumina Powder, Reduced, Dry)
TRC-P141045-1G 1 g

Palladium (5% on Alumina Powder, Reduced, Dry)

Sign In for Pricing
View Details
DUSP13 (NM_001007272) Human Over-expression Lysate
LC423481 20 µg

DUSP13 (NM_001007272) Human Over-expression Lysate

Sign In for Pricing
View Details
Benzyl 2-Acetamido-2-deoxy-6-O-(Beta-D-galactopyranosyl)-Alpha-D-galactopyranoside
TRC-B212531-25MG 25 mg

Benzyl 2-Acetamido-2-deoxy-6-O-(Beta-D-galactopyranosyl)-Alpha-D-galactopyranoside

Sign In for Pricing
View Details
CD104 (UM-A9), Biotin conjugate, 0.1mg/mL
BNCB0449-100 1x 100 µL

CD104 (UM-A9), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details