Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0995 (MJ0995)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0995 (MJ0995) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0995

UniProt

Q58402

Expression Region

1-227

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYGDYMKYMKKIVLFLIINILPILILGLYLYANIGGAEDVKEVIENSPFKEFTYIDHKTL MMLKNDVNLKNMPEFYKESIILINGIYIGNHGSFGIKIPLGFLIKYIPIDNFKYYNGVLI KNLNEDDLGKAEMNDLVNTIPPNYKDVLIYRENYTIGIYYDLNSNKTYLIEVFRKPNNQE IDTEKLRNELLQKTNAVDCNVVDMGDKVYVYLEFNGIDLNLINNGIT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF405S conjugate, 0.1mg/mL
BNC043789-500 1x 500 µL

CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (rCR2/1952), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PTPRS Antibody
KC-8471-01 50 μL

PTPRS Antibody

Sign In for Pricing
View Details
PTPRS Antibody
KC-8471-02 100 µL

PTPRS Antibody

Sign In for Pricing
View Details
PTPRS Antibody
KC-8471-03 1 mL

PTPRS Antibody

Sign In for Pricing
View Details
Mucin 3 (MUC3/1154), CF640R conjugate, 0.1mg/mL
BNC401154-100 1x 100 µL

Mucin 3 (MUC3/1154), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse IgG3 Isotype Control
AM08210RC7-N 100 Tests

Mouse IgG3 Isotype Control

Sign In for Pricing
View Details