Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Probable N-acetyltransferase CML5 (Cml5)

This Recombinant Mouse Probable N-acetyltransferase CML5 (Cml5) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Probable N-acetyltransferase CML5, EC= 2.3.1.-, Camello-like protein 5

UniProt

Q9QXS8

Expression Region

1-227

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPYQIRQYQERDYKLVVGLFSRGMMEHIPAAFRYTLLLPQTLLFLFVMPLTIVLVFGSW LLAVICIFFLLLLLRLLAGQPFKDYVAQCLQTDMADITRSYLNAHGSFWVAESGGLVVGT VGGLPVKDPPLGRKQMQLFHLSVSSQHRGQGIAKALVRTVFQFARDQGYSDVVLETSVIQ QSAITLYEAMGFQRTGKYSEISIIKWLITFSIIHFTYSFPSTQKHEL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hif1a Mouse Gene Knockout Kit (CRISPR)
KN307708RB 1 Kit

Hif1a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Xirp1 activation kit by CRISPRa
GA204651 1 Kit

Mouse Xirp1 activation kit by CRISPRa

Sign In for Pricing
View Details
PPIL5 (LRR1) Human Gene Knockout Kit (CRISPR)
KN419090 1 Kit

PPIL5 (LRR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Fura-8™, pentasodium salt
21058-AAT 1 mg

Fura-8™, pentasodium salt

Sign In for Pricing
View Details
TIMM50 Human Gene Knockout Kit (CRISPR)
KN424744 1 Kit

TIMM50 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TBX1 Human qPCR Primer Pair (NM_080647)
HP226193 200 Reactions

TBX1 Human qPCR Primer Pair (NM_080647)

Sign In for Pricing
View Details