Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Spermatogenesis-associated protein 25 (SPATA25)

This Recombinant Human Spermatogenesis-associated protein 25 (SPATA25) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Spermatogenesis-associated protein 25, Testis-specific gene 23 protein

UniProt

Q9BR10

Expression Region

1-227

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYFRTPQTHPGPLPSGQGGAASPGLSLGLCSPVEPVVVASGGTGPLSQKAEQVAPAAQA WGPALAMPQARGCPGGTSWETLRKEYSRNCHKFPHVRQLESLGWDNGYSRSRAPDLGGPS RPRPLMLCGLSPRVLPVPSEAVGKEASSQPDICILTLAMMIAGIPTVPVPGVREEDLIWA AQAFMMAHPEPEGAVEGARWEQAHAHTASGKMPLVRSKRGQPPGSCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPE-iFluor® 647-streptavidin conjugate
16906-AAT 100 µg

RPE-iFluor® 647-streptavidin conjugate

Sign In for Pricing
View Details
Ambroxol HCl
SIH-153-50MG 50 mg

Ambroxol HCl

Sign In for Pricing
View Details
Ski Mouse Gene Knockout Kit (CRISPR)
KN515822 1 Kit

Ski Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS506781 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
8-Thioguanosine
TRC-T350788-2MG 2 mg

8-Thioguanosine

Sign In for Pricing
View Details
Clec12b Mouse Gene Knockout Kit (CRISPR)
KN503429 1 Kit

Clec12b Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details