Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rabbit Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Rabbit Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

P98049

Expression Region

1-227

Origin

Oryctolagus cuniculus (Rabbit)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYPFQLGFQDASSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS YMIPTSDLNPGDLRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATLISTRPGLFYGQCSEICGSNHSFMPIVLEMVPLKHFENWSLSMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dock2 Rat Pre-designed siRNA Set A
HY-RS24646 1 Set

Dock2 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details
Phospho-KSR1 (Ser404) Rabbit pAb
E47R16868 100 µL

Phospho-KSR1 (Ser404) Rabbit pAb

Sign In for Pricing
View Details
Naringin Dihydrochalcone (Naringin DC)
E1KS2389 1 g

Naringin Dihydrochalcone (Naringin DC)

Sign In for Pricing
View Details
CFHL4 Rabbit Polyclonal Antibody (Biotin)
orb456252 100 µL

CFHL4 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
PLV3-U6-Hdac6-sgRNA2-Cas9-EGFP-Puro Plasmid
PVT79771 2 µg

PLV3-U6-Hdac6-sgRNA2-Cas9-EGFP-Puro Plasmid

Sign In for Pricing
View Details
FAM151A Recombinant Protein (Rat)
RP200438 100 µg

FAM151A Recombinant Protein (Rat)

Sign In for Pricing
View Details