Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Cytochrome c oxidase subunit 2 (Mtco2)

This Recombinant Mouse Cytochrome c oxidase subunit 2 (Mtco2) spans the amino acid sequence from region 1-227.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

P00405

Expression Region

1-227

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYPFQLGLQDATSPIMEELMNFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE VETIWTILPAVILIMIALPSLRILYMMDEINNPVLTVKTMGHQWYWSYEYTDYEDLCFDS YMIPTNDLKPGELRLLEVDNRVVLPMELPIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN QATVTSNRPGLFYGQCSEICGSNHSFMPIVLEMVPLKYFENWSASMI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Persephin ELISA Kit
IMSPSPNKT 1 Each

Mouse Persephin ELISA Kit

Sign In for Pricing
View Details
NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) BioAssayTM ELISA Kit (Mouse) discontinued
357668-01 48 Tests

NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) BioAssayTM ELISA Kit (Mouse) discontinued
357668-02 96 Tests

NOX4 (Nicotinamide Adenine Dinucleotide Phosphate Oxidase 4) BioAssayTM ELISA Kit (Mouse) discontinued

Sign In for Pricing
View Details
MSS51 Antibody, FITC conjugated
A56670-100UG 100 µg

MSS51 Antibody, FITC conjugated

Sign In for Pricing
View Details
Elagolix Impurity 63
RM-E120163-01 10 mg

Elagolix Impurity 63

Sign In for Pricing
View Details
Elagolix Impurity 63
RM-E120163-02 25 mg

Elagolix Impurity 63

Sign In for Pricing
View Details