Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Membrane protein (M)

This Recombinant Murine coronavirus Membrane protein (M) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P08549

Expression Region

1-228

Origin

Murine coronavirus (strain JHM) (MHV-JHM) (Murine hepatitis virus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTTQAPGPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSMFIYVVKMIIL WLMWPLIIVLCMFNCVYALNNVYLGFSIVFTIVSVVMWIMYFVNSIRLFIRTGSWWSFNP ETNNLMCIDMKGTVYVRPIIEDYHTLTATIIRGHFYMQGVKLGTGFSLSDLPAYVTVAKV SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGADTVLLRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SSH1 Antibody Picoband® Fluoro550 Conjugated
A03480-Fluoro550 100 µg/Vial

Anti-SSH1 Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
Animal-Free NAP-2/CXCL7, Human (His)
HY-P700049AF-01 2 µg

Animal-Free NAP-2/CXCL7, Human (His)

Sign In for Pricing
View Details
Animal-Free NAP-2/CXCL7, Human (His)
HY-P700049AF-02 10 µg

Animal-Free NAP-2/CXCL7, Human (His)

Sign In for Pricing
View Details
Animal-Free NAP-2/CXCL7, Human (His)
HY-P700049AF-03 50 µg

Animal-Free NAP-2/CXCL7, Human (His)

Sign In for Pricing
View Details
Rabbit Anti-Human Rab11-FIP3 Polyclonal Antibody
PA91232HU-01 50 µg

Rabbit Anti-Human Rab11-FIP3 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human Rab11-FIP3 Polyclonal Antibody
PA91232HU-02 100 µg

Rabbit Anti-Human Rab11-FIP3 Polyclonal Antibody

Sign In for Pricing
View Details