Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Membrane protein (M)

This Recombinant Murine coronavirus Membrane protein (M) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P03415

Expression Region

1-228

Origin

Murine coronavirus (strain A59) (MHV-A59) (Murine hepatitis virus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTTQAPEPVYQWTADEAVQFLKEWNFSLGIILLFITIILQFGYTSRSMFIYVVKMIIL WLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVIWIMYFVNSIRLFIRTGSWWSFNP ETNNLMCIDMKGTVYVRPIIEDYHTLTATIIRGHLYMQGVKLGTGFSLSDLPAYVTVAKV SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGADTALLRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pactolus CRISPR Activation Plasmid (m2)
sc-421174-ACT-2 20 µg

Pactolus CRISPR Activation Plasmid (m2)

Sign In for Pricing
View Details
Mouse Cathepsin B, cath-B ELISA Kit
MBS160147-01 48 Well

Mouse Cathepsin B, cath-B ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin B, cath-B ELISA Kit
MBS160147-02 96 Well

Mouse Cathepsin B, cath-B ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin B, cath-B ELISA Kit
MBS160147-03 5x 96 Well

Mouse Cathepsin B, cath-B ELISA Kit

Sign In for Pricing
View Details
Mouse Cathepsin B, cath-B ELISA Kit
MBS160147-04 10x 96 Well

Mouse Cathepsin B, cath-B ELISA Kit

Sign In for Pricing
View Details
Human Zinc finger and BTB domain-containing protein 3 ELISA Kit
MBS288746-01 48 Well

Human Zinc finger and BTB domain-containing protein 3 ELISA Kit

Sign In for Pricing
View Details