Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Interferon-induced transmembrane protein 10 (IFITM10)

This Recombinant Human Interferon-induced transmembrane protein 10 (IFITM10) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Interferon-induced transmembrane protein 10

UniProt

A6NMD0

Expression Region

1-228

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MREGKRGPPCILSFRGTLERVEAQWELEAQGPGQCPAPLGDPASTTDGAQEARVPLDGAF WIPRPPAGSPKGCFACVSKPPALQAPAAPAPEPSASPPMAPTLFPMESKSSKTDSVRAAG APPACKHLAEKKTMTNPTTVIEVYPDTTEVNDYYLWSIFNFVYLNFCCLGFIALAYSLKV RDKKLLNDLNGAVEDAKTARLFNITSSALAASCIILVFIFLRYPLTDY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aig1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6104703 1.0 µg DNA

Aig1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Helz Mouse shRNA Plasmid (Locus ID 78455)
TR505278 1 Kit

Helz Mouse shRNA Plasmid (Locus ID 78455)

Sign In for Pricing
View Details
ENO3 Antibody
GWB-MR060F 100 µg

ENO3 Antibody

Sign In for Pricing
View Details
AKT1 Monoclonal Antibody AE00130
AE00130 0.1mg

AKT1 Monoclonal Antibody AE00130

Sign In for Pricing
View Details
Tmsb10 (NM_025284) Mouse Recombinant Protein
TP521735 20 µg

Tmsb10 (NM_025284) Mouse Recombinant Protein

Sign In for Pricing
View Details
PIAS2 Rabbit Monoclonal Antibody
orb866498 100 µL

PIAS2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details