Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Populus alba Chloroplast envelope membrane protein (cemA)

This Recombinant Populus alba Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q14FE5

Expression Region

1-228

Origin

Populus alba (White poplar)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEKKAFIPLLYLTSIVFLPWWVSFSFNKSLGSWIINWWNTSKSETFLNDIQEKSILEKLI EFEELFLLDEMIKEYPETHLQKFRIGIHKETIQLIKMHNADRIDTILHFSTNIICFVILS GYSFLVNEELFILNSWVQEFIYNLSDTIKALSILLLTDLCIGFHSPHGWELMISSFYKDF GFAHNDQIISGLVSTFPVIFDTIFKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pcdhb9 ORF Vector (Rat) (pORF)
36161016 1.0 µg DNA

Pcdhb9 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
BTN2A2 Mouse mAb
E2222843 100 µL

BTN2A2 Mouse mAb

Sign In for Pricing
View Details
Anti-CDH6 / K-Cadherin (HKT288)
C00410-01 1 mg

Anti-CDH6 / K-Cadherin (HKT288)

Sign In for Pricing
View Details
Anti-CDH6 / K-Cadherin (HKT288)
C00410-02 5x 1 mg

Anti-CDH6 / K-Cadherin (HKT288)

Sign In for Pricing
View Details
Anti-CDH6 / K-Cadherin (HKT288)
C00410-03 25x 1 mg

Anti-CDH6 / K-Cadherin (HKT288)

Sign In for Pricing
View Details
RNU7-71P ORF Vector (Human) (pORF)
ORF029828 1.0 µg DNA

RNU7-71P ORF Vector (Human) (pORF)

Sign In for Pricing
View Details