Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Ankyrin repeat domain-containing protein 46 (ANKRD46)

This Recombinant Bovine Ankyrin repeat domain-containing protein 46 (ANKRD46) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Ankyrin repeat domain-containing protein 46

UniProt

Q3SX00

Expression Region

1-228

Origin

Bos taurus (Bovine)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFNYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADLLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLIFVIALLSLGIAYYVSGVLPFVENQPELVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CRAT (NM_000755) Human Over-expression Lysate
LC400255 20 µg

CRAT (NM_000755) Human Over-expression Lysate

Sign In for Pricing
View Details
SLAMF1 pTyr281 Rabbit Polyclonal Antibody
AP12953PU-N 400 µL

SLAMF1 pTyr281 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
BIRC5 antibody
FNab09909 100 µg

BIRC5 antibody

Sign In for Pricing
View Details
MFSD2A Human Gene Knockout Kit (CRISPR)
KN204264 1 Kit

MFSD2A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS709515 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
3-Acetyl-3-chlorodihydrofuranone
TRC-A172030-250MG 250 mg

3-Acetyl-3-chlorodihydrofuranone

Sign In for Pricing
View Details