Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Ankyrin repeat domain-containing protein 46 (Ankrd46)

This Recombinant Rat Ankyrin repeat domain-containing protein 46 (Ankrd46) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Ankyrin repeat domain-containing protein 46, Ankyrin repeat small protein, ANK-S

UniProt

Q76K24

Expression Region

1-228

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADPLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLESLEEQEVKGFNRGTHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPGLVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEC14L1 (NM_001143998) Human Over-expression Lysate
LY428458 100 µg

SEC14L1 (NM_001143998) Human Over-expression Lysate

Sign In for Pricing
View Details
CD62E (SELE) (NM_000450) Human Recombinant Protein
TP321153 20 µg

CD62E (SELE) (NM_000450) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse IgG2b Antibody ATTO 550 Conjugated Pre-adsorbed
TA397878 500 µg

Mouse IgG2b Antibody ATTO 550 Conjugated Pre-adsorbed

Sign In for Pricing
View Details
CARD9 (521-536) Rabbit Polyclonal Antibody
AP07688PU-N 50 µg

CARD9 (521-536) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Sucrose 6’-Acetate, Technical grade 80%
TRC-S697040-250MG 250 mg

Sucrose 6’-Acetate, Technical grade 80%

Sign In for Pricing
View Details
Anti-2019-nCoV Spike Neutralizing Antibody
E-AB-V1024-01 20 µL

Anti-2019-nCoV Spike Neutralizing Antibody

Sign In for Pricing
View Details