Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ankyrin repeat domain-containing protein 46 (Ankrd46)

This Recombinant Mouse Ankyrin repeat domain-containing protein 46 (Ankrd46) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Ankyrin repeat domain-containing protein 46, Ankyrin repeat small protein, ANK-S

UniProt

Q8BTZ5

Expression Region

1-228

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADPLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLESLEEQEVKGFNRGAHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPELVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Ficolin 2 (FCN2) activation kit by CRISPRa
GA101556 1 Kit

Human Ficolin 2 (FCN2) activation kit by CRISPRa

Sign In for Pricing
View Details
2-Benzyloxy-benzoic Acid-13C3 Benzyl Ester
TRC-B285587-5MG 5 mg

2-Benzyloxy-benzoic Acid-13C3 Benzyl Ester

Sign In for Pricing
View Details
2-Keto-D-Glucose
TRC-K191000-50MG 50 mg

2-Keto-D-Glucose

Sign In for Pricing
View Details
EPS8L1 (N-term) Rabbit Polyclonal Antibody
AP51447PU-N 400 µL

EPS8L1 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RABL3 (NM_173825) Human Recombinant Protein
TP305024M 100 µg

RABL3 (NM_173825) Human Recombinant Protein

Sign In for Pricing
View Details
TIA1 Recombinant Rabbit monoclonal Antibody
HA750385 100 µL

TIA1 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details