Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Ankyrin repeat domain-containing protein 46 (Ankrd46)

This Recombinant Mouse Ankyrin repeat domain-containing protein 46 (Ankrd46) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Ankyrin repeat domain-containing protein 46, Ankyrin repeat small protein, ANK-S

UniProt

Q8BTZ5

Expression Region

1-228

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSYVFVNDSSQTNVPLLQACIDGDFTYSKRLLESGFDPNIRDSRGRTGLHLAAARGNVDI CQLLHKFGADPLATDYQGNTALHLCGHVDTIQFLVSNGLKIDICNHQGATPLVLAKRRGV NKDVIRLLESLEEQEVKGFNRGAHSKLETMQTAESESAMESHSLLNPNLQQGEGVLSSFR TTWQEFVEDLGFWRVLLLILVIALLSLGIAYYVSGVLPFVDNQPELVH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MHC II, Mouse (MK-D6), 1mg/mL
BNUM2007-50 1x 50 µL

MHC II, Mouse (MK-D6), 1mg/mL

Sign In for Pricing
View Details
Rpl21 Mouse Gene Knockout Kit (CRISPR)
KN515024 1 Kit

Rpl21 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TXNDC17 antibody
FNab09124 100 µg

TXNDC17 antibody

Sign In for Pricing
View Details
NPIPB5 Human Gene Knockout Kit (CRISPR)
KN427697 1 Kit

NPIPB5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD44 Polyclonal Antibody
D-AB-10184L-01 25 µL

CD44 Polyclonal Antibody

Sign In for Pricing
View Details
CD44 Polyclonal Antibody
D-AB-10184L-02 100 µL

CD44 Polyclonal Antibody

Sign In for Pricing
View Details