Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat coronavirus Membrane protein (M)

This Recombinant Rat coronavirus Membrane protein (M) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

Q9IKC7

Expression Region

1-228

Origin

Rat coronavirus (strain 681) (RCV-SDAV) (Sialodacryoadenitis virus SDAV-681)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTTPAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSMFIYVVKMIIL WLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIMYFVNSIRLFIRTGSWWSFNP ETNNLMCIDVKGTVYVRPIIEDYHTLTATNVRGHLYMQGVKLGTGFSLSDLPAYVTVAKV SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGADTALLRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1,2-Bis(2,4,6-tribromophenoxy)ethane
TRC-B585425-1G 1 g

1,2-Bis(2,4,6-tribromophenoxy)ethane

Sign In for Pricing
View Details
VTA1 Antibody
KC-17268-01 50 μL

VTA1 Antibody

Sign In for Pricing
View Details
VTA1 Antibody
KC-17268-02 100 µL

VTA1 Antibody

Sign In for Pricing
View Details
VTA1 Antibody
KC-17268-03 1 mL

VTA1 Antibody

Sign In for Pricing
View Details
Mouse Dnajc5b activation kit by CRISPRa
GA206711 1 Kit

Mouse Dnajc5b activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant Creatine kinase B type Monoclonal Antibody
AN301963L-01 50 µL

Recombinant Creatine kinase B type Monoclonal Antibody

Sign In for Pricing
View Details