Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat coronavirus Membrane protein (M)

This Recombinant Rat coronavirus Membrane protein (M) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

Q9IKC7

Expression Region

1-228

Origin

Rat coronavirus (strain 681) (RCV-SDAV) (Sialodacryoadenitis virus SDAV-681)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSTTPAPQTVYQWTADVAVRFLKEWNFLLGIILLFITIILQFGYTSRSMFIYVVKMIIL WLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIVMWIMYFVNSIRLFIRTGSWWSFNP ETNNLMCIDVKGTVYVRPIIEDYHTLTATNVRGHLYMQGVKLGTGFSLSDLPAYVTVAKV SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGADTALLRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Adssl1 activation kit by CRISPRa
GA200108 1 Kit

Mouse Adssl1 activation kit by CRISPRa

Sign In for Pricing
View Details
Farletuzumab Biosimilar - Research Grade
ICH5114-50mg 50 mg

Farletuzumab Biosimilar - Research Grade

Sign In for Pricing
View Details
Tissue Protein Lysate, Lung
CP565762 150 µg

Tissue Protein Lysate, Lung

Sign In for Pricing
View Details
ZHX1 (NM_001017926) Human Over-expression Lysate
LY422755 100 µg

ZHX1 (NM_001017926) Human Over-expression Lysate

Sign In for Pricing
View Details
T785991
TRC-T785991-25MG 25 mg

T785991

Sign In for Pricing
View Details
Standard Fume Hood BFSD-206
BFSD-206 1 Unit

Standard Fume Hood BFSD-206

Sign In for Pricing
View Details