Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Murine coronavirus Membrane protein (M)

This Recombinant Murine coronavirus Membrane protein (M) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

Q9JEB4

Expression Region

1-228

Origin

Murine coronavirus (strain 2) (MHV-2) (Murine hepatitis virus)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNSTTQAPQPVYQWTADEAIRFLKEWNFSLGIILLFVTIILQFGYTSRSMFVYVVKMILL WLMWPLTIVLCIFNCVYALNNVYLGFSIVFTIVSIIMWIMYFVNSIRLFIRTGSWWSFNP ETNNLMCTDMKGTVYVRPIIEDYHTLTATIIRGHLYMQGVKLGTGFSLSDLPAYVTVAKV SHLCTYKRAFLDKVDGVSGFAVYVKSKVGNYRLPSNKPSGMDTALLRI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cripto1 (TDGF1) Rabbit Polyclonal Antibody
TA365418 100 µL

Cripto1 (TDGF1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), CF647 conjugate, 0.1mg/mL
BNC472241-500 1x 500 µL

Glutathione S-Transferase Mu1 (GSTM1) (CPTC-GSTMu1-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Porcine Lipopolysaccharide Binding Protein (LBP) ELISA Kit
RDR-LBP-p-01 96 Tests

Porcine Lipopolysaccharide Binding Protein (LBP) ELISA Kit

Sign In for Pricing
View Details
Porcine Lipopolysaccharide Binding Protein (LBP) ELISA Kit
RDR-LBP-p-02 48 Tests

Porcine Lipopolysaccharide Binding Protein (LBP) ELISA Kit

Sign In for Pricing
View Details
Kcnc1 pSer503 Rabbit Polyclonal Antibody
AP08729PU-N 100 µL

Kcnc1 pSer503 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
OCT3 Antibody
8C0283-AAT 50 µg

OCT3 Antibody

Sign In for Pricing
View Details