Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Probable N-acetyltransferase CML3 (Cml3)

This Recombinant Rat Probable N-acetyltransferase CML3 (Cml3) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Probable N-acetyltransferase CML3, EC= 2.3.1.-, Camello-like protein 3

UniProt

Q9QXS4

Expression Region

1-228

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPYHIRKYQDSDHRSVVNLFCRGTEEHISASFRYMLLLPGTLLILLGVPLTLFLASGSW LLVLLSTLTLLVSLWLLAKYPWEKYTAMCLHSDMADIPRTYLSSHYSCFWVAESRGQMVG IIAVLPVKDPLLQRKQLQLRHLSVSLEHRREGIGRAMVRTALQFAEMQGFSEVVLVTSML QYAALALYQSMGFQKTGEFFYTFVSRLRNSPMICLKYCLTSALNDLKT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MDM2 Antibody
F42269-0.4ML 0.4 mL

MDM2 Antibody

Sign In for Pricing
View Details
WAY 629 Hydrochloride
TRC-W498728-100MG 100 mg

WAY 629 Hydrochloride

Sign In for Pricing
View Details
GCOM1 (MYZAP) (NM_001018100) Human Over-expression Lysate
LY422651 100 µg

GCOM1 (MYZAP) (NM_001018100) Human Over-expression Lysate

Sign In for Pricing
View Details
Pyruvic Acid-13C2
TRC-P998907-1MG 1 mg

Pyruvic Acid-13C2

Sign In for Pricing
View Details
Xk Mouse Gene Knockout Kit (CRISPR)
KN519490 1 Kit

Xk Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ERK1 / ERK2 (N-term) Rabbit Polyclonal Antibody
AP23276PU-N 100 µg

ERK1 / ERK2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details