Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dinodon semicarinatum Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Dinodon semicarinatum Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-228.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, EC= 1.9.3.1, Cytochrome c oxidase polypeptide II

UniProt

O79549

Expression Region

1-228

Origin

Dinodon semicarinatum (Ryukyu odd-tooth snake) (Eumesodon semicarinatus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPHASQLSLQEAMGPTMEEVIFLHDHVLLLTCLMTMVITMFTLTATTTALTHNDPTEEVE QLEAAWTVAPIMILILTALPSVRSLYLMEEVFNPYLTIKATGHQWYWNYEYSDGVKISFD SYMIQTKDLQNGSPRLLEVDHRMVMPAGLQTRVVVTAEDVLHSWTIPSLGVKVDAVPGRL NQLPLATSRVGVFYGQCSEICGANHSFMPIAMEATPLHHFEQWLISEQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL
BNC041050-500 1x 500 µL

CD3e (CRIS-7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL
BNC680253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF594 conjugate, 0.1mg/mL
BNC940152-500 1x 500 µL

CD11c (HC1/1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL
BNC741820-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (KRT8) (rB22.1), CF594 conjugate, 0.1mg/mL
BNC942175-100 1x 100 µL

Cytokeratin 8 (KRT8) (rB22.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details