Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Petunia sp. Chlorophyll a-b binding protein 37, chloroplastic (CAB37)

This Recombinant Petunia sp. Chlorophyll a-b binding protein 37, chloroplastic (CAB37) spans the amino acid sequence from region 38-265.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 37, chloroplastic, LHCII type I CAB-37, LHCP

UniProt

P12062

Expression Region

38-265

Origin

Petunia sp. (Petunia)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RRTVKSAPQSIWYGEDRPKYLGPFSEQTPSYLTGEFPGDYGWDTAGLSADPETFARNREL EVIHCRWAMLGALGCVFPEILSKNGVTFGEAVWFKAGSQIFSEGGLDYLGNPNLIHAQSI LAIWAAQVVLMGFVEGYRVGGGPLGEGLDKIYPGGAFDPLGLADDPEAFAELKVKEIKNG RLAMFSMFGFFVQAIVTGKGPIENLYDHVADPVANNAWAFATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Papillomavirus 16 (E7) (HPV16/E7) ELISA Kit
EIA07235h 1 Kit

Human Papillomavirus 16 (E7) (HPV16/E7) ELISA Kit

Sign In for Pricing
View Details
CD83 (HB15a) L
sc-19677 L 200 µg - 0.1 mL

CD83 (HB15a) L

Sign In for Pricing
View Details
CSNK1A1 Antibody
A11811-100UG 100 µg

CSNK1A1 Antibody

Sign In for Pricing
View Details
pLV2-CMV-WNT1-FLAG-mCherry Plasmid
PVT52458 2 µg

pLV2-CMV-WNT1-FLAG-mCherry Plasmid

Sign In for Pricing
View Details
IMPG1 polyclonal antibody
BS76761-01 50 µL

IMPG1 polyclonal antibody

Sign In for Pricing
View Details
IMPG1 polyclonal antibody
BS76761-02 100 µL

IMPG1 polyclonal antibody

Sign In for Pricing
View Details