Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Illicium oligandrum Chloroplast envelope membrane protein (cemA)

This Recombinant Illicium oligandrum Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

A6MMV6

Expression Region

1-229

Origin

Illicium oligandrum (Star anise)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPKRKALTPFPYLASIVFLPWGISLSFNKSLESWVINWWNTRQSETFLNDIQEKKVLERF IELEELFLLDEMIKEYSGTHIQKLRIGIYKETIQLVRMHNQDHIHLILHFSTNIICFTIL SAYSILGNEELVILNSWVQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELMIGLVYQN FGFAHNEQVISGLVSTFPVIIDTILKYWIFLFLNRVSPSLVVIYHSMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-500 1x 500 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-500 1x 500 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD6 (C6/372), CF647 conjugate, 0.1mg/mL
BNC470372-100 1x 100 µL

CD6 (C6/372), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL
BNC402337-500 1x 500 µL

TRAcP (Tartrate-Resistant Acid Phosphatase) (Hairy Cell Leukemia Marker) (rACP5/1070), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 5/6/18 (LP34), CF568 conjugate, 0.1mg/mL
BNC682036-500 1x 500 µL

Cytokeratin 5/6/18 (LP34), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL
BNC741859-500 1x 500 µL

Von Willebrand Factor / Factor VIII Related-Ag (Endothelial Marker) (VWF/1859R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details