Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Plastid envelope membrane protein (cemA)

This Recombinant Cuscuta reflexa Plastid envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Plastid envelope membrane protein

UniProt

A7M974

Expression Region

1-229

Origin

Cuscuta reflexa (Southern Asian dodder)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKAFSPIFHLSFIVFLPWGIYLSFKKCLGSWITNWWNTSESEIFLNIIQEKSILENF IELEEFLFVEEIFKNNSETHPQEFHTGIHKEAIQFIKIQNESYIHMILRLSTNLICVVII SGFYIWRNETLVILNSWSREFLYNLSDTVKVFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVQNDRIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTPN6, Phosphorylated (Y536) (Protein Tyrosine Phosphatase Non-receptor Type 6, HCP, HCPH, SHP1, SHP-1, HPTP1C, PTP-1C, SHP-1L, SH-PTP1) (MaxLight 490)
MBS6434246-01 0.1 mL

PTPN6, Phosphorylated (Y536) (Protein Tyrosine Phosphatase Non-receptor Type 6, HCP, HCPH, SHP1, SHP-1, HPTP1C, PTP-1C, SHP-1L, SH-PTP1) (MaxLight 490)

Sign In for Pricing
View Details
PTPN6, Phosphorylated (Y536) (Protein Tyrosine Phosphatase Non-receptor Type 6, HCP, HCPH, SHP1, SHP-1, HPTP1C, PTP-1C, SHP-1L, SH-PTP1) (MaxLight 490)
MBS6434246-02 5x 0.1 mL

PTPN6, Phosphorylated (Y536) (Protein Tyrosine Phosphatase Non-receptor Type 6, HCP, HCPH, SHP1, SHP-1, HPTP1C, PTP-1C, SHP-1L, SH-PTP1) (MaxLight 490)

Sign In for Pricing
View Details
Olfr112 AAV Vector (Mouse) (CMV)
32595104 1 µg

Olfr112 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
SMO (Smoothened Homolog (Drosophila), Gx, SMOH) (MaxLight 750)
MBS6240661-01 0.1 mL

SMO (Smoothened Homolog (Drosophila), Gx, SMOH) (MaxLight 750)

Sign In for Pricing
View Details
SMO (Smoothened Homolog (Drosophila), Gx, SMOH) (MaxLight 750)
MBS6240661-02 5x 0.1 mL

SMO (Smoothened Homolog (Drosophila), Gx, SMOH) (MaxLight 750)

Sign In for Pricing
View Details
Rat secretory IgA Rabbit Polyclonal Antibody
orb11330-01 50 μL

Rat secretory IgA Rabbit Polyclonal Antibody

Sign In for Pricing
View Details