Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cuscuta reflexa Plastid envelope membrane protein (cemA)

This Recombinant Cuscuta reflexa Plastid envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Plastid envelope membrane protein

UniProt

A7M974

Expression Region

1-229

Origin

Cuscuta reflexa (Southern Asian dodder)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKAFSPIFHLSFIVFLPWGIYLSFKKCLGSWITNWWNTSESEIFLNIIQEKSILENF IELEEFLFVEEIFKNNSETHPQEFHTGIHKEAIQFIKIQNESYIHMILRLSTNLICVVII SGFYIWRNETLVILNSWSREFLYNLSDTVKVFSILLLTDLCIGFHSPHGWELMIGSIYKD FGFVQNDRIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMP2 Polyclonal Antibody
E98851 100 µL

PMP2 Polyclonal Antibody

Sign In for Pricing
View Details
MCAM Polyclonal Antibody
A71130-050 50 µL

MCAM Polyclonal Antibody

Sign In for Pricing
View Details
TXNIP Antibody
OACD07614-100UL 100 µL

TXNIP Antibody

Sign In for Pricing
View Details
CD244 Polyclonal Antibody
MBS2536610-01 0.02 mL

CD244 Polyclonal Antibody

Sign In for Pricing
View Details
CD244 Polyclonal Antibody
MBS2536610-02 0.06 mL

CD244 Polyclonal Antibody

Sign In for Pricing
View Details
CD244 Polyclonal Antibody
MBS2536610-03 0.12 mL

CD244 Polyclonal Antibody

Sign In for Pricing
View Details