Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Guizotia abyssinica Chloroplast envelope membrane protein (cemA)

This Recombinant Guizotia abyssinica Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

B2LMK5

Expression Region

1-229

Origin

Guizotia abyssinica (Niger) (Ramtilla)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKAFTPLLYLASIVFLPWWISLLFQKSLESWVTNWWNTRQSETFLNDIEEKSILEKF IELEELLFLEEMIKEYSETHLQNLRIGIHKETIQLIKIHNEGRIHTILHFSTNIICFIIL SGYSIFGNKELVILNSWAQEFLYNLSDTIKAFSLLLLTDLCIGFHSPHGWELMIGFVYKD FGFVHNDQIISGLVSTFPVILDTIFKYWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-100 1x 100 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FOXP3 (3G3), CF640R conjugate, 0.1mg/mL
BNC400645-100 1x 100 µL

FOXP3 (3G3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL
BNC940669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-100 1x 100 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details