What is the catalog number for Recombinant Uncharacterized protein T19C3.4 (T19C3.4)?

The catalog number for Recombinant Uncharacterized protein T19C3.4 (T19C3.4) is orb2928497.

What sizes are available for Recombinant Uncharacterized protein T19C3.4 (T19C3.4)?

Recombinant Uncharacterized protein T19C3.4 (T19C3.4) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Uncharacterized protein T19C3.4 (T19C3.4) come in?

Recombinant Uncharacterized protein T19C3.4 (T19C3.4) is available in 2 different pack sizes.

Recombinant Uncharacterized protein T19C3.4 (T19C3.4)

Q: Is Recombinant Uncharacterized protein T19C3.4 (T19C3.4) in stock?

Recombinant Uncharacterized protein T19C3.4 (T19C3.4) is currently made to order / not held in immediate stock. Contact us for lead time.

This Recombinant Uncharacterized protein T19C3.4 (T19C3.4) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Uncharacterized protein T19C3.4

UniProt

Q10010

Expression Region

1-229

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSETLSRLLIITAGTLYPAYRSYKAVRTKDTREYVKWMMYWIVFAIYSFLENLLDLVLAF WFPFYFQLKIVFIFWLLSPWTKGASILYRKWVHPTLNRHEKDIDALLESAKSESYNQLMR IGSKSLVYAKDVVAEAAVRGQQQLVNQLQRSYSANDVGSEREALTKNINIVKIEELDENS DTDLQKSPRPRRRASSRSRSRSRTIDSGADSEFTTAATIPRRSARKPIH