Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Panax ginseng Chloroplast envelope membrane protein (cemA)

This Recombinant Panax ginseng Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q68RZ4

Expression Region

1-229

Origin

Panax ginseng (Korean ginseng)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKKKAFTPLLYLASLVFLPWWISLSFNKSLESWVTNWWNTRQSEIFLNGIQEKNILEKF IELEEILLLEEMIKEYSETHLQNLRIGIHKETIQFIKIHNEDRIHTILHFSTNIICFVIL SGYSIWGNEELVILNSWAQEFLYNLSDTIKAFSILLLTDLCIGFHSPHGWELIIGSVYKD FGFVHNDQILSGLVSTFPVILDTLFKFWIFRYLNRVSPSLVVIYHSMND

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Integrin beta-4 Antibody
RC-15560-01 50 μL

Recombinant Integrin beta-4 Antibody

Sign In for Pricing
View Details
Recombinant Integrin beta-4 Antibody
RC-15560-02 100 µL

Recombinant Integrin beta-4 Antibody

Sign In for Pricing
View Details
Recombinant Integrin beta-4 Antibody
RC-15560-03 1 mL

Recombinant Integrin beta-4 Antibody

Sign In for Pricing
View Details
CD34 (HPCA1/763), CF640R conjugate, 0.1mg/mL
BNC400763-100 1x 100 µL

CD34 (HPCA1/763), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human AGP1 (Alpha-1-Acid Glycoprotein 1) ELISA Kit
E-UNEL-H0254-01 5x 96 Tests

Uncoated Human AGP1 (Alpha-1-Acid Glycoprotein 1) ELISA Kit

Sign In for Pricing
View Details
Uncoated Human AGP1 (Alpha-1-Acid Glycoprotein 1) ELISA Kit
E-UNEL-H0254-02 15x 96 Tests

Uncoated Human AGP1 (Alpha-1-Acid Glycoprotein 1) ELISA Kit

Sign In for Pricing
View Details