Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio CD99 antigen-like protein 2 (cd99l2)

This Recombinant Danio rerio CD99 antigen-like protein 2 (cd99l2) spans the amino acid sequence from region 24-252.

Product Specifications

Product Name Alternative

CD99 antigen-like protein 2, CD_antigen= CD99

UniProt

Q6DBW9

Expression Region

24-252

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DGLDLADALGDDDDDEPTTKPPKADPGAGGAGGAAVKPTLKPVKPTVKEPAKPKPKQTGL DDFDLADALNPDNDIKGKGKDSGKGDKEVGGGSRDDGTPNSRGSQFSDDDLLDVGNDNSY KPDKGKGGKGGSSSNVGDLDPADDNNYDTMAETGTIAGIVSAVAMALVGAVSSYISYQKK KLCFSIQQSLNADMVKADAPDAVVAQEPQVQQTLLQPPNAEPPTEENAV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human OR10J1-Strep full length protein-synthetic nanodisc
MBS1883554-01 0.01 mg

Human OR10J1-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human OR10J1-Strep full length protein-synthetic nanodisc
MBS1883554-02 0.05 mg

Human OR10J1-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Human OR10J1-Strep full length protein-synthetic nanodisc
MBS1883554-03 0.1 mg

Human OR10J1-Strep full length protein-synthetic nanodisc

Sign In for Pricing
View Details
Tert-Butyl ((2-fluoro-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzyl) oxy) dimethylsilane
PC50225 1 Each

Tert-Butyl ((2-fluoro-3- (4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl) benzyl) oxy) dimethylsilane

Sign In for Pricing
View Details
NUBP2 Antibody, Biotin conjugated
A72286-100UG 100 µg

NUBP2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
2-Butoxy-5-methylbenzoic acid
OR1080231 1 Each

2-Butoxy-5-methylbenzoic acid

Sign In for Pricing
View Details