Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chloroplast envelope membrane protein (cemA)

This Recombinant Chloroplast envelope membrane protein (cemA) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Chloroplast envelope membrane protein

UniProt

Q70XZ1

Expression Region

1-229

Origin

Amborella trichopoda

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSKKKALTSLPYLASIVFLPWGISLSFNKSLEPWVTNWWNTSQYETLLNEIQENNVLERF IELEELFLLDEMIRDYPETHIQKLRIGIHKETIELVKMYNQDYIHIISHFSTNIMSFAIL SAYSILGNEELVTLNSWVQEFFYNLSDTIKAFSILLLTDSCIGFHSPHGWELMIGSVYKD FGFSHNDQIISGLVSTFPVILDTILKYWIFHHLNRISPSLVVIYHSMNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Acad9 Mouse Gene Knockout Kit (CRISPR)
KN500690 1 Kit

Acad9 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Epstein-Barr Virus (LMP-1) (CS2), CF405S conjugate, 0.1mg/mL
BNC041742-100 1x 100 µL

Epstein-Barr Virus (LMP-1) (CS2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOI Hydrochloride
TRC-D535763-50MG 50 mg

DOI Hydrochloride

Sign In for Pricing
View Details
ORC4L (ORC4) Human Gene Knockout Kit (CRISPR)
KN401587 1 Kit

ORC4L (ORC4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Quercetin 3,4'-Diglucoside
TRC-Q509480-25MG 25 mg

Quercetin 3,4'-Diglucoside

Sign In for Pricing
View Details
RPL26L1 (NM_016093) Human Recombinant Protein
TP305652 20 µg

RPL26L1 (NM_016093) Human Recombinant Protein

Sign In for Pricing
View Details