Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein ML0869 (ML0869)

This Recombinant Uncharacterized protein ML0869 (ML0869) spans the amino acid sequence from region 1-229.

Product Specifications

Product Name Alternative

Uncharacterized protein ML0869

UniProt

Q9CCF6

Expression Region

1-229

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKLLGRKKSYGQDIETSDDNVGSEASLPDTLSRGSSTTAPKGRPTRKRDDADRRHTKKGP ITPAPMTASEARARRKSLAPPKCHRAERRAKRAASKAQITDRRERMMAGEEAYLPPRDQG PVRRYIRDLVDARRNALGLFTPSALVLLFITFGVPQLQLYMSPAMLVLLSVMGIDGIILG RKISKLVDVKFPSNTESHWRLGLYAAGRASQMRRLRVPRPQVEHGSSVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human FBXW9 activation kit by CRISPRa
GA113458 1 Kit

Human FBXW9 activation kit by CRISPRa

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF405S conjugate, 0.1mg/mL
BNC040940-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
OOEP (NM_001080507) Human Over-expression Lysate
LC421062 20 µg

OOEP (NM_001080507) Human Over-expression Lysate

Sign In for Pricing
View Details
CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF568 conjugate, 0.1mg/mL
BNC681547-500 1x 500 µL

CD137L / 4-1BBL / TNFSF9 (CD137L/1547), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDGF (NM_001126051) Human Over-expression Lysate
LY426633 100 µg

HDGF (NM_001126051) Human Over-expression Lysate

Sign In for Pricing
View Details
Acid Phosphatase 2 (ACP2) (NM_001131064) Human Over-expression Lysate
LY427374 100 µg

Acid Phosphatase 2 (ACP2) (NM_001131064) Human Over-expression Lysate

Sign In for Pricing
View Details