Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycine max Chlorophyll a-b binding protein 3, chloroplastic (CAB3)

This Recombinant Glycine max Chlorophyll a-b binding protein 3, chloroplastic (CAB3) spans the amino acid sequence from region 34-263.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 3, chloroplastic, LHCII type I CAB-3, LHCP

UniProt

P09756

Expression Region

34-263

Origin

Glycine max (Soybean) (Glycine hispida)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RKTVTKQVSSGSPWYGPDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFAKNR ELEVIHSRWAMLGALGCVFPELLSRNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLIHAQ SILAIWATQVILMGAVEGYRIAGGPLGEVTDPIYPGGSFDPLGLADDPEAFAELKVKELK NGRLAMFSMFGFFVQAIVTGKGPLENLADHLAGPVNNNAWAYATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster IP10 ELISA Kit
E108768 1 Each

Hamster IP10 ELISA Kit

Sign In for Pricing
View Details
FCF1 CRISPRa sgRNA lentivector (set of three targets)(Rat)
20379126 3x 1.0µg DNA

FCF1 CRISPRa sgRNA lentivector (set of three targets)(Rat)

Sign In for Pricing
View Details
Anti-Phospho-MDM2-(S166) antibody
STJ22283 100 µl

Anti-Phospho-MDM2-(S166) antibody

Sign In for Pricing
View Details
NLRP8 (NM_176811) Human Tagged Lenti ORF Clone
RC218775L4 10 µg

NLRP8 (NM_176811) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GPR88 Polyclonal Antibody, Cy5 Conjugated
bs-12017R-Cy5 100 µL

GPR88 Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
Mmu-miR-196a-1-3p antagomir
HY-RI02791A-01 5 nmol

Mmu-miR-196a-1-3p antagomir

Sign In for Pricing
View Details