Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pichinde arenavirus Pre-glycoprotein polyprotein GP complex (GPC)

This Recombinant Pichinde arenavirus Pre-glycoprotein polyprotein GP complex (GPC) spans the amino acid sequence from region 274-503.

Product Specifications

Product Name Alternative

Pre-glycoprotein polyprotein GP complex, Pre-GP-C, Cleaved into the following 3 chains:, 1. Stable signal peptide, 2. SSP, 3. Glycoprotein G1, 4. GP1, 5. Glycoprotein G2

UniProt

P03540

Expression Region

274-503

Origin

Pichinde arenavirus (PICV)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

GFFTWDLSDSSGQHVPGGYCLEQWAIIWAGIKCFDNTVMAKCNKDHNEEFCDTMRLFDFN QNAIKTLQLNVENSLNLFKKTINGLISDSLVIRNSLKQLAKIPYCNYTKFWYINDTITGR HSLPQCWLVHNGSYLNETHFKNDWLWESQNLYNEMLMKEYEERQGKTPLALTDICFWSLV FYTITVFLHIVGIPTHRHIIGDGCPKPHRITRNSLCSCGYYKYQRNLTNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)
MBS1237270-01 0.02 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)
MBS1237270-02 0.1 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)
MBS1237270-03 1 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

Sign In for Pricing
View Details
Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)
MBS1237270-04 5x 1 mg (E-Coli)

Recombinant Human immunodeficiency virus type 1 group M subtype C Protein Vpr (vpr)

Sign In for Pricing
View Details
Il5ra 3'UTR Luciferase Stable Cell Line
TU110082 1.0 mL

Il5ra 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Lentiviral human FAM166C sgRNA gene knockout kit - Lentiviral human FAM166C sgRNA gene knockout kit (25)
GTR15399084 1 Vial

Lentiviral human FAM166C sgRNA gene knockout kit - Lentiviral human FAM166C sgRNA gene knockout kit (25)

Sign In for Pricing
View Details