Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Endomucin (Emcn)

This Recombinant Rat Endomucin (Emcn) spans the amino acid sequence from region 21-250.

Product Specifications

Product Name Alternative

Endomucin

UniProt

Q6AY82

Expression Region

21-250

Origin

Rattus norvegicus (Rat)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ENSKALTETSTTKASATTPDMVSITNKSTGGTPPKGTTNSATPKTPLMPALDSPTTPKHE TTTRGVIKNEVSTIKTTVANPTISNAVSTLSSPQNKTENQSSIRTTEISGTNQLPDDQKP KTTETPSASLTTAKTISQIQDTEDGKITATTSTTPSYSSVILPVVIALIVITVLVFTLVG LYRICWKRDPGTPESGNDQPQSDKESVKLLTVKTISHESGEHSAQGKAKN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Fgf2 activation kit by CRISPRa
GA201400 1 Kit

Mouse Fgf2 activation kit by CRISPRa

Sign In for Pricing
View Details
ITPR2 Polyclonal Antibody
E-AB-18139-01 20 µL

ITPR2 Polyclonal Antibody

Sign In for Pricing
View Details
ITPR2 Polyclonal Antibody
E-AB-18139-02 60 µL

ITPR2 Polyclonal Antibody

Sign In for Pricing
View Details
ITPR2 Polyclonal Antibody
E-AB-18139-03 120 µL

ITPR2 Polyclonal Antibody

Sign In for Pricing
View Details
ITPR2 Polyclonal Antibody
E-AB-18139-04 200 µL

ITPR2 Polyclonal Antibody

Sign In for Pricing
View Details
Tissue Total RNA, Skin
CR562616 5 µg

Tissue Total RNA, Skin

Sign In for Pricing
View Details