Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsular polysaccharide biosynthesis protein CpsC (cpsC)

This Recombinant Capsular polysaccharide biosynthesis protein CpsC (cpsC) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Capsular polysaccharide biosynthesis protein CpsC

UniProt

Q54519

Expression Region

1-230

Origin

Streptococcus pneumoniae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKEQNTLEIDVLQLFRALWKRKLVILLVAIITSSVAFAYSTFVIKPEFTSMTRIYVVNRD QGEKSGLTNQDLQAGSSLVKDYREIILSQDVLEEVVSDLKLDLTPKDLANKIKVTVPVDT RIVSVSVSDRVPEEASRIANSLREVAAQKIISITRVSDVTTLEEARPATSPSSPNIKRST LIGFLAGVIGTSVIVLILELLDTRVKRPKDIEDTLQMTLLGIVPNLNKLK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SERTM1 Double Nickase Plasmid (h2)
sc-416350-NIC-2 20 µg

SERTM1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
TAS2R19 siRNA (Human)
orb1851444-01 15 nmol

TAS2R19 siRNA (Human)

Sign In for Pricing
View Details
TAS2R19 siRNA (Human)
orb1851444-02 30 nmol

TAS2R19 siRNA (Human)

Sign In for Pricing
View Details
Klrd1 Mouse Gene Knockout Kit (CRISPR)
KN508942 1 Kit

Klrd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
FACL4 (ACSL4) Rabbit Monoclonal Antibody [Clone ID: R07-4E3]
TA383660 100 µL

FACL4 (ACSL4) Rabbit Monoclonal Antibody [Clone ID: R07-4E3]

Sign In for Pricing
View Details
TBC1D26 Antibody; Biotin conjugated
MBS7005631-01 0.05 mg

TBC1D26 Antibody; Biotin conjugated

Sign In for Pricing
View Details