Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Ashbya gossypii Protein ROT1 (ROT1)

This Recombinant Ashbya gossypii Protein ROT1 (ROT1) spans the amino acid sequence from region 24-253.

Product Specifications

Product Name Alternative

Protein ROT1

UniProt

Q755J8

Expression Region

24-253

Origin

Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) (Yeast) (Eremothecium gossypii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

QSAKDLYGTWSAKSNQVFTGPGFYNPADELLIEPSLPGISYSFTEDGFFEMATYRVSGNP RNLACPSAVMTFQHGKYEILANGTLILRPFEVDGRQLVSEPCVDKGVSTYLRYSQVETFQ RFAVELDEYQGKHALHLFQFDGSPVQPLYLAYRPPLMLPTITLNPTDHAGATATAGPGHR KRSLGELVRAGLQDKHKTTAVRNPSLFNAAFYWWCSAGVIAAGTVLFFMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calpain 2 Antibody
R12-2051-01 50 μL

Calpain 2 Antibody

Sign In for Pricing
View Details
Calpain 2 Antibody
R12-2051-02 100 µL

Calpain 2 Antibody

Sign In for Pricing
View Details
SHC (SHC1) (NM_183001) Human Tagged ORF Clone
RC224734 10 µg

SHC (SHC1) (NM_183001) Human Tagged ORF Clone

Sign In for Pricing
View Details
ACAP1 Lentiviral Activation Particles (h)
sc-405104-LAC 200 µL

ACAP1 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
E330021D16Rik Protein Vector (Mouse) (pPM-C-HA)
PV174148 500 ng

E330021D16Rik Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
Conjugated CBL (Phospho-Tyr774) Rabbit mAb
C14270 100 µL

Conjugated CBL (Phospho-Tyr774) Rabbit mAb

Sign In for Pricing
View Details