Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Membrane protein (M)

This Recombinant Bovine coronavirus Membrane protein (M) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P69600

Expression Region

1-230

Origin

Bovine coronavirus (strain OK-0514) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITVILQFGYTSRSMFVYVIKMIILW LMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNPE TNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKVS HLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF130 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated
bs-9252R-BF488 100 µL

RNF130 Polyclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
1-Fluoro-3- (methoxymethoxy) -2-methyl-5- (trifluoromethyl) benzene
PC1017330-01 250 mg

1-Fluoro-3- (methoxymethoxy) -2-methyl-5- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Fluoro-3- (methoxymethoxy) -2-methyl-5- (trifluoromethyl) benzene
PC1017330-02 500 mg

1-Fluoro-3- (methoxymethoxy) -2-methyl-5- (trifluoromethyl) benzene

Sign In for Pricing
View Details
1-Fluoro-3- (methoxymethoxy) -2-methyl-5- (trifluoromethyl) benzene
PC1017330-03 1 g

1-Fluoro-3- (methoxymethoxy) -2-methyl-5- (trifluoromethyl) benzene

Sign In for Pricing
View Details
Lentiviral mouse Urb2 shRNA (UAS) - Lentiviral mouse Urb2 shRNA (UAS, RFP) (25)
GTR15179351 1 Vial

Lentiviral mouse Urb2 shRNA (UAS) - Lentiviral mouse Urb2 shRNA (UAS, RFP) (25)

Sign In for Pricing
View Details
Cortisol, BioAssayTM ELISA Kit (Guinea Pig) discontinued
227577-01 48 Tests

Cortisol, BioAssayTM ELISA Kit (Guinea Pig) discontinued

Sign In for Pricing
View Details