Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine coronavirus Membrane protein (M)

This Recombinant Bovine coronavirus Membrane protein (M) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P69705

Expression Region

1-230

Origin

Bovine coronavirus (strain Quebec) (BCoV) (BCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMFVYVIKMIILW LMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNPE TNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKVS HLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802R-01 20 Tests

Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802R-02 100 Tests

Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802R-03 2x 100 Tests

Elab Fluor® Violet 500 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF640R conjugate, 0.1mg/mL
BNC402980-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2980R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802I-01 20 Tests

PE/Cyanine5.5 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details
PE/Cyanine5.5 Mouse IgG2a, κ Isotype Control[C1.18.4]
E-AB-F09802I-02 100 Tests

PE/Cyanine5.5 Mouse IgG2a, κ Isotype Control[C1.18.4]

Sign In for Pricing
View Details