Recombinant Escherichia coli UPF0702 transmembrane protein ycaP (ycaP)
This Recombinant Escherichia coli UPF0702 transmembrane protein ycaP (ycaP) spans the amino acid sequence from region 1-230.
Product Specifications
Product Name Alternative
UPF0702 transmembrane protein ycaP
UniProt
P75839
Expression Region
1-230
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MKAFDLHRMAFDKVPFDFLGEVALRSLYTFVLVFLFLKMTGRRGVRQMSLFEVLIILTLG SAAGDVAFYDDVPMVPVLIVFITLALLYRLVMWLMAHSEKLEDLLEGKPVVIIEDGELAW SKLNNSNMTEFEFFMELRLRGVEQLGQVRLAILETNGQISVYFFEDDKVKPGLLILPSDC TQRYKVVPESADYACIRCSEIIHMKAGEKQLCPRCANPEWTKASRAKRVT
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740009-500 1x 500 µL
MART-1 / Melan-A (M2-7C10), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040454-500 1x 500 µL
Neurofilament (NF-H) (RT-97), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041077-100 1x 100 µL
Cytokeratin, LMW (KRTL/1077), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC472130-500 1x 500 µL
Cytokeratin 3 (KRT3) (Corneal Epithelial Marker) (KRT3/2130), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details