Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Capsular polysaccharide biosynthesis protein CpsC (cpsC)

This Recombinant Capsular polysaccharide biosynthesis protein CpsC (cpsC) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Capsular polysaccharide biosynthesis protein CpsC

UniProt

P0C0T8

Expression Region

1-230

Origin

Streptococcus agalactiae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNKIANTEVEINIFNLLKKLWKKKFLITFVAIAFATAGLFYSLFIVTPQYTSSTRIYVIN PNTPNNSITAQDLQAGSFLANDYKEIITSTDVLEKVISSEKLNYPSSQLLQKITVSILKD TRVISISVEDANPKMSQKLANSVREAAVSKIKAVTQVEDITTLEKGNLPKAPSSPNIKKN VLIGFIVGAGLSTIVLVIMGILDDRVNTEEDIEKVLGLTSLGIVPDLNKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Glutathione peroxidase 3, GPX3 ELISA Kit
MBS1605000-01 48 Well

Mouse Glutathione peroxidase 3, GPX3 ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione peroxidase 3, GPX3 ELISA Kit
MBS1605000-02 96 Well

Mouse Glutathione peroxidase 3, GPX3 ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione peroxidase 3, GPX3 ELISA Kit
MBS1605000-03 5x 96 Well

Mouse Glutathione peroxidase 3, GPX3 ELISA Kit

Sign In for Pricing
View Details
Mouse Glutathione peroxidase 3, GPX3 ELISA Kit
MBS1605000-04 10x 96 Well

Mouse Glutathione peroxidase 3, GPX3 ELISA Kit

Sign In for Pricing
View Details
Ruxolitinib (S enantiomer)
T6156-01 1 mL - 10 mM (in DMSO)

Ruxolitinib (S enantiomer)

Sign In for Pricing
View Details
Ruxolitinib (S enantiomer)
T6156-02 5 mg

Ruxolitinib (S enantiomer)

Sign In for Pricing
View Details