Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Turkey enteric coronavirus Membrane protein (M)

This Recombinant Turkey enteric coronavirus Membrane protein (M) spans the amino acid sequence from region 1-230.

Product Specifications

Product Name Alternative

Membrane protein, M protein, E1 glycoprotein, Matrix glycoprotein, Membrane glycoprotein

UniProt

P26021

Expression Region

1-230

Origin

Turkey enteric coronavirus (TCoV) (TCV)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSVTTPAPVYTWTADEAIKFLKEWNFSLGIILLFITIILQFGYTSRSMSVYVIKMIILW LMWPLTIILTIFNCVYALNNVYLGFSIVFTIVAIIMWIVYFVNSIRLFIRTGSWWSFNPE TNNLMCIDMKGRMYVRPIIEDYHTLTVTIIRGHLYMQGIKLGTGYSLSDLPAYVTVAKVS HLLTYKRGFLDKIGDTSGFAVYVKSKVGNYRLPSTQKGSGMDTALLRNNI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human KEL/CD238 Protein (His Tag)
PKSH032671-01 10 µg

Recombinant Human KEL/CD238 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human KEL/CD238 Protein (His Tag)
PKSH032671-02 50 µg

Recombinant Human KEL/CD238 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Activin A Receptor Type IB Antibody
RC-4347-01 50 μL

Recombinant Activin A Receptor Type IB Antibody

Sign In for Pricing
View Details
Recombinant Activin A Receptor Type IB Antibody
RC-4347-02 100 µL

Recombinant Activin A Receptor Type IB Antibody

Sign In for Pricing
View Details
Recombinant Activin A Receptor Type IB Antibody
RC-4347-03 1 mL

Recombinant Activin A Receptor Type IB Antibody

Sign In for Pricing
View Details
TMEM184B (NM_012264) Human Over-expression Lysate
LC402182 20 µg

TMEM184B (NM_012264) Human Over-expression Lysate

Sign In for Pricing
View Details