Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Probable membrane glycoprotein (BILF2)

This Recombinant Epstein-Barr virus Probable membrane glycoprotein (BILF2) spans the amino acid sequence from region 18-248.

Product Specifications

Product Name Alternative

Probable membrane glycoprotein

UniProt

P03218

Expression Region

18-248

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FFSDLVKFENVTAHAGARVNLTCSVPSNESVSRIELGRGYTPGDGQLPLAVATSNNGTHI TNGGYNYSLTLEWVNDSNTSVSLIIPNVTLAHAGYYTCNVTLRNCSVASGVHCNYSAGEE DDQYHANRTLTQRMHLTVIPATTIAPTTLVSHTTSTSHRPHRRPVSKRPTHKPVTLGPFP IDPWRPKTTWVHWALLLITCAVVAPVLLIIIISCLGWLAGWGRRRKGWIPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LGR5, NT (LGR5, GPR49, GPR67, Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38) (MaxLight 550) discontinued
037761-ML550 100 µL

LGR5, NT (LGR5, GPR49, GPR67, Leucine-rich repeat-containing G-protein coupled receptor 5, G-protein coupled receptor 49, G-protein coupled receptor 67, G-protein coupled receptor HG38) (MaxLight 550) discontinued

Sign In for Pricing
View Details
Monarch Bead Retainers
T3004L 100 Pieces

Monarch Bead Retainers

Sign In for Pricing
View Details
SLC10A4 (NM_152679) Human Tagged ORF Clone
RG205738 10 µg

SLC10A4 (NM_152679) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Legionella Pneumophila rpiA Protein (aa 1-216) (strain Paris)
VAng-Lsx04503-50gEcoli 50 µg (E. coli)

Recombinant Legionella Pneumophila rpiA Protein (aa 1-216) (strain Paris)

Sign In for Pricing
View Details
OLFM4 Polyclonal Antibody
NHP-AB412 Each

OLFM4 Polyclonal Antibody

Sign In for Pricing
View Details
HIws1 siRNA (h)
sc-94726 10 µM

HIws1 siRNA (h)

Sign In for Pricing
View Details