Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Epstein-Barr virus Probable membrane glycoprotein (BILF2)

This Recombinant Epstein-Barr virus Probable membrane glycoprotein (BILF2) spans the amino acid sequence from region 18-248.

Product Specifications

Product Name Alternative

Probable membrane glycoprotein

UniProt

P03218

Expression Region

18-248

Origin

Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

FFSDLVKFENVTAHAGARVNLTCSVPSNESVSRIELGRGYTPGDGQLPLAVATSNNGTHI TNGGYNYSLTLEWVNDSNTSVSLIIPNVTLAHAGYYTCNVTLRNCSVASGVHCNYSAGEE DDQYHANRTLTQRMHLTVIPATTIAPTTLVSHTTSTSHRPHRRPVSKRPTHKPVTLGPFP IDPWRPKTTWVHWALLLITCAVVAPVLLIIIISCLGWLAGWGRRRKGWIPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human/Mouse LRRTM2 Affinity Purified Polyclonal Ab
AF5589-SP 25 µg

Human/Mouse LRRTM2 Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
Bead Lysis Kit LYS2M1
LYS2M1 50 Preparations

Bead Lysis Kit LYS2M1

Sign In for Pricing
View Details
Human CLCN6 Knockout A549 cell line
GTR15417781 1 Vial

Human CLCN6 Knockout A549 cell line

Sign In for Pricing
View Details
ELISA Kit For Serotonin N-acetyltransferase
E1937b 96 Tests

ELISA Kit For Serotonin N-acetyltransferase

Sign In for Pricing
View Details
Lentiviral human LPP shRNA (UAS) - Lentiviral human LPP shRNA (UAS) (25)
GTR15130973 1 Vial

Lentiviral human LPP shRNA (UAS) - Lentiviral human LPP shRNA (UAS) (25)

Sign In for Pricing
View Details
Recql4 Rat shRNA Plasmid (Locus ID 300057)
TL708533 1 Kit

Recql4 Rat shRNA Plasmid (Locus ID 300057)

Sign In for Pricing
View Details