Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1293 (MJ1293)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ1293 (MJ1293) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ1293

UniProt

Q58689

Expression Region

1-231

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTNKTRKETNEIKNNITLPPNIKTEVNRTSKYDFTNLSKDLEIVYALIKITGFDEYLPFN IENLNKIFIKEKISPYPYLLNLIKDLIILFVIGLIITIIGLLMYEPTRPKVISIIASILY KLKIKEKPKPKKKETIKLPKPPKIYISDVIYSLGDTVRIEISSEIDIGNNLYILSPTNKK YKIELIKTGKNKYLGLFKIPENEVPGQYFIIYKPENLSIGGFLVVDIKKEM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME2 Rabbit Polyclonal Antibody
TA379174 100 µL

NME2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]
AM31226PU-N 2 mL (200 Tests)

CD45 (PTPRC) (CD45RA) Mouse Monoclonal Antibody [Clone ID: B-C15]

Sign In for Pricing
View Details
SIN1 (MAPKAP1) (NM_001006618) Human Over-expression Lysate
LC400381 20 µg

SIN1 (MAPKAP1) (NM_001006618) Human Over-expression Lysate

Sign In for Pricing
View Details
ALDH1A2 Polyclonal Antibody
E-AB-16146-01 20 µL

ALDH1A2 Polyclonal Antibody

Sign In for Pricing
View Details
ALDH1A2 Polyclonal Antibody
E-AB-16146-02 60 µL

ALDH1A2 Polyclonal Antibody

Sign In for Pricing
View Details
ALDH1A2 Polyclonal Antibody
E-AB-16146-03 120 µL

ALDH1A2 Polyclonal Antibody

Sign In for Pricing
View Details