Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lagothrix lagotricha Cytochrome c oxidase subunit 2 (MT-CO2)

This Recombinant Lagothrix lagotricha Cytochrome c oxidase subunit 2 (MT-CO2) spans the amino acid sequence from region 1-231.

Product Specifications

Product Name Alternative

Cytochrome c oxidase subunit 2, Cytochrome c oxidase polypeptide II

UniProt

P98036

Expression Region

1-231

Origin

Lagothrix lagotricha (Common woolly monkey)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAHPAQLGLQNATSPIMEELIAFHDHALMIIFLISSLVLYIISLMLTTKLTHTSTMNAQE IEMVWTILPAIILIMIALPSLRILYMTDEFNKPYLTLKAIGHQWYWSYEYSDYVDLAFDY YITPTYFLEPGEFRLLEVDNRTTLPMEADIRMLISSQDVLHSWAVPSLGVKTDAIPGRLN QAMLASMRPGLFYGQCSEICGSNHSFMPIVLEFIYFQDFEVWASYLYIVSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD11c (HC1/1), CF740 conjugate, 0.1mg/mL
BNC740152-500 1x 500 µL

CD11c (HC1/1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
BNC740304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL
BNC741081-100 1x 100 µL

CD45RO (190-2F2.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
BNC401003-500 1x 500 µL

Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL
BNC880177-100 1x 100 µL

CD50 (ICAM-3) (101-1D2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details