Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1)

This Recombinant Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1) spans the amino acid sequence from region 36-266.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 1, chloroplastic, LHCII type I CAB-1, LHCP

UniProt

P13851

Expression Region

36-266

Origin

Sinapis alba (White mustard) (Brassica hirta)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RKTVKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNR ELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQ SILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEI KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDCA8 Polyclonal Antibody
E-AB-10868-01 20 µL

CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
CDCA8 Polyclonal Antibody
E-AB-10868-02 60 µL

CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
CDCA8 Polyclonal Antibody
E-AB-10868-03 120 µL

CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
CDCA8 Polyclonal Antibody
E-AB-10868-04 200 µL

CDCA8 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse PHD finger protein 14 (PHF14) ELISA Kit
abx538655 96 Tests

Mouse PHD finger protein 14 (PHF14) ELISA Kit

Sign In for Pricing
View Details
Serum Zinc Microplate Assay Kit
E51K1110 100 Assays

Serum Zinc Microplate Assay Kit

Sign In for Pricing
View Details