Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1)

This Recombinant Sinapis alba Chlorophyll a-b binding protein 1, chloroplastic (CAB1) spans the amino acid sequence from region 36-266.

Product Specifications

Product Name Alternative

Chlorophyll a-b binding protein 1, chloroplastic, LHCII type I CAB-1, LHCP

UniProt

P13851

Expression Region

36-266

Origin

Sinapis alba (White mustard) (Brassica hirta)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

RKTVKPTGPSGSPWYGSDRVKYLGPFSGEPPSYLTGEFPGDYGWDTAGLSADPETFARNR ELEVIHCRWAMLGALGCVFPELLARNGVKFGEAVWFKAGSQIFSEGGLDYLGNPSLVHAQ SILAIWATQVILMGAVEGYRVAGEGPLGEAEDLLYPGGSFDPLGLATDPEAFAELKVKEI KNGRLAMFSMFGFFVQAIVTGKGPLENLADHLADPVNNNAWAFATNFVPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pancreatic Polypeptide (31-36) (human)
5-01710 4x 5 mg

Pancreatic Polypeptide (31-36) (human)

Sign In for Pricing
View Details
DDX6
CSB-CL006640HU 10 μg Plasmid + 200 μL Glycerol

DDX6

Sign In for Pricing
View Details
Lck Antibody
AF6100-01 100 µL

Lck Antibody

Sign In for Pricing
View Details
Lck Antibody
AF6100-02 200 µL

Lck Antibody

Sign In for Pricing
View Details
Recombinant Streptococcus pneumoniae Prolipoprotein diacylglyceryl transferase (lgt)
MBS1141697 Inquire

Recombinant Streptococcus pneumoniae Prolipoprotein diacylglyceryl transferase (lgt)

Sign In for Pricing
View Details
Fam19a5 AAV siRNA Pooled Vector
19916166 1.0 µg

Fam19a5 AAV siRNA Pooled Vector

Sign In for Pricing
View Details